Anti-B4GALNT4

Catalog Number: ATA-HPA043276
Article Name: Anti-B4GALNT4
Biozol Catalog Number: ATA-HPA043276
Supplier Catalog Number: HPA043276
Alternative Catalog Number: ATA-HPA043276-100,ATA-HPA043276-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ25045, NGalNAc-T1
Clonality: Polyclonal
Isotype: IgG
NCBI: 338707
UniProt: Q76KP1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YGRDGEKLTSETDGRGVHAAPSTQRAEDSSESREEEQAPEGRDLDMLFPGGAGRLPLNFTHQTPPWREEY
Target: B4GALNT4
Antibody Type: Monoclonal Antibody
HPA043276-100ul