Anti-JMY

Catalog Number: ATA-HPA043308
Article Name: Anti-JMY
Biozol Catalog Number: ATA-HPA043308
Supplier Catalog Number: HPA043308
Alternative Catalog Number: ATA-HPA043308-100,ATA-HPA043308-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ37870
junction mediating and regulatory protein, p53 cofactor
Anti-JMY
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 133746
UniProt: Q8N9B5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VSSVRIVSASGTVSEEIEVLEMVKEDEAPLALSDAEQPPPATELESPAEECSWAGLFSFQDLRAVHQQLCSVNSQLEPCLPVFPEEPSGMWTVLF
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: JMY
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.
Western blot analysis in human cell line EFO-21.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
HPA043308-100ul
HPA043308-100ul
HPA043308-100ul