Anti-SNTN
Catalog Number:
ATA-HPA043322
- Images (9)
| Article Name: | Anti-SNTN |
| Biozol Catalog Number: | ATA-HPA043322 |
| Supplier Catalog Number: | HPA043322 |
| Alternative Catalog Number: | ATA-HPA043322-100,ATA-HPA043322-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ44379, S100AL |
| sentan, cilia apical structure protein |
| Anti-SNTN |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 132203 |
| UniProt: | A6NMZ2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | HSTQDKSLHLEGDPNPSAAPTSTCAPRKMPKRISISKQLASVKALRKCSDLEKAIATTALIFRNSSDSDGKLE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SNTN |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-SNTN antibody. Corresponding SNTN RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, fallopian tube, prostate and testis using Anti-SNTN antibody HPA043322 (A) shows similar protein distribution across tissues to independent antibody HPA058399 (B). |
|
|
Immunohistochemical staining of human fallopian tube shows high expression. |
|
|
Immunohistochemical staining of human prostate shows low expression as expected. |
|
|
Immunohistochemical staining of human testis using Anti-SNTN antibody HPA043322. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-SNTN antibody HPA043322. |
|
|
HPA043322-100ul |
|
|
HPA043322-100ul |
|
|
HPA043322-100ul |
Product Guarantee and Expert Support
