Anti-FUT8 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA043410
Article Name: Anti-FUT8 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA043410
Supplier Catalog Number: HPA043410
Alternative Catalog Number: ATA-HPA043410-100,ATA-HPA043410-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
NCBI: 2530
UniProt: Q9BYC5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: WSGEVKDKNVQVVELPIVDSLHPRPPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVIGVHVRRTD
Target: FUT8