Anti-C4orf19
Catalog Number:
ATA-HPA043458
- Images (9)
| Article Name: | Anti-C4orf19 |
| Biozol Catalog Number: | ATA-HPA043458 |
| Supplier Catalog Number: | HPA043458 |
| Alternative Catalog Number: | ATA-HPA043458-100,ATA-HPA043458-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ11017 |
| chromosome 4 open reading frame 19 |
| Anti-C4orf19 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 55286 |
| UniProt: | Q8IY42 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VPSPGYVNEVNSCKLDEDDTDKLKGKWSSEVLVQKNDPQRQGSKKTESSSRTADPWEPCWPHQGPLPQGDAGGEHHACGVNGIGPAATPQPTGNSSPT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | C4orf19 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line RT4 shows localization to microtubule organizing center & cell junctions. |
|
|
Immunohistochemistry analysis in human stomach and skin tissues using Anti-C4orf19 antibody. Corresponding C4orf19 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human stomach shows high expression. |
|
|
Immunohistochemical staining of human skin shows low expression as expected. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and C4orf19 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413148). |
|
|
|
|
|
HPA043458-100ul |
|
|
HPA043458-100ul |
|
|
HPA043458-100ul |
Product Guarantee and Expert Support
