Anti-FBXW4

Catalog Number: ATA-HPA043496
Article Name: Anti-FBXW4
Biozol Catalog Number: ATA-HPA043496
Supplier Catalog Number: HPA043496
Alternative Catalog Number: ATA-HPA043496-100,ATA-HPA043496-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: dactylin, Fbw4, SHFM3
F-box and WD repeat domain containing 4
Anti-FBXW4
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 6468
UniProt: P57775
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QCLHTIQTEDRVWSIAISPLLSSFVTGTACCGHFSPLRIWDLNSGQLMTHLGSDFPPGAGVLDVMYESPFTLLSCGYD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FBXW4
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
HPA043496-100ul
HPA043496-100ul
HPA043496-100ul