Anti-RAVER1
Catalog Number:
ATA-HPA043575
- Images (9)
| Article Name: | Anti-RAVER1 |
| Biozol Catalog Number: | ATA-HPA043575 |
| Supplier Catalog Number: | HPA043575 |
| Alternative Catalog Number: | ATA-HPA043575-100,ATA-HPA043575-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA1978 |
| ribonucleoprotein, PTB-binding 1 |
| Anti-RAVER1 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 125950 |
| UniProt: | Q8IY67 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KSDLLGKPLGPRTLYVHWTDAGQLTPALLHSRCLCVDRLPPGFNDVDALCRALSAVHSPTFCQLACGQDGQLKGFAVLEYETAE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RAVER1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human small intestine and liver tissues using HPA043575 antibody. Corresponding RAVER1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human lymph node shows moderate nuclear positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human small intestine shows moderate nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Western blot analysis in human cell lines HEK293 and SK-MEL-30 using Anti-RAVER1 antibody. Corresponding RAVER1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1. |
|
|
HPA043575-100ul |
|
|
HPA043575-100ul |
|
|
HPA043575-100ul |
Product Guarantee and Expert Support
