Anti-CABLES2

Catalog Number: ATA-HPA043597
Article Name: Anti-CABLES2
Biozol Catalog Number: ATA-HPA043597
Supplier Catalog Number: HPA043597
Alternative Catalog Number: ATA-HPA043597-100,ATA-HPA043597-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C20orf150, dJ908M14.2, ik3-2
Clonality: Polyclonal
Concentration: 0,4
NCBI: 81928
UniProt: Q9BTV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: AKFLYPTNALVTHKSDSHGLLPTPRPSVPRTLPGSRHKPAPTKSAPASTELGSDVGDTLEYNPN
Target: CABLES2
HPA043597-100ul