Anti-DNAJC16
Catalog Number:
ATA-HPA043643
- Images (6)
| Article Name: | Anti-DNAJC16 |
| Biozol Catalog Number: | ATA-HPA043643 |
| Supplier Catalog Number: | HPA043643 |
| Alternative Catalog Number: | ATA-HPA043643-100,ATA-HPA043643-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Molekularbiologie |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA0962 |
| DnaJ (Hsp40) homolog, subfamily C, member 16 |
| Anti-DNAJC16 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 23341 |
| UniProt: | Q9Y2G8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TKTSLLQKFALEVYTFTGSSCLHFSFLSLDKHREWLEYLLEFAQDAAPIPNQYDKHFMERDYTGYVLALNGHKKYFCLFKPQKTVEEEEAIGSCSDVDSSLYLGESRGKPSCGLGSRPIKGKLSKLSLWMER |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DNAJC16 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles. |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules. |
|
|
|
|
|
HPA043643-100ul |
|
|
HPA043643-100ul |
|
|
HPA043643-100ul |
Product Guarantee and Expert Support
