Anti-MRPL3
Catalog Number:
ATA-HPA043665
| Article Name: |
Anti-MRPL3 |
| Biozol Catalog Number: |
ATA-HPA043665 |
| Supplier Catalog Number: |
HPA043665 |
| Alternative Catalog Number: |
ATA-HPA043665-100,ATA-HPA043665-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
MRL3, RPML3 |
| mitochondrial ribosomal protein L3 |
| Clonality: |
Polyclonal |
| Concentration: |
0.1 mg/ml |
| Isotype: |
IgG |
| NCBI: |
11222 |
| UniProt: |
P09001 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
GKSGTWWDEHLSEENVPFIKQLVSDEDKAQLASKLCPLKDEPWPIHPWEPGSFRVGLIALKLGMMPLWTKDGQKHVVTLLQVQDCHVLKYTSKENCNGK |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: |
MRPL3 |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells. |
|
Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells. |
|
Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells. |
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules. |
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
HPA043665-100ul |
|
|
|
HPA043665-100ul |
|
HPA043665-100ul |