Anti-ITK

Catalog Number: ATA-HPA043670
Article Name: Anti-ITK
Biozol Catalog Number: ATA-HPA043670
Supplier Catalog Number: HPA043670
Alternative Catalog Number: ATA-HPA043670-100,ATA-HPA043670-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: EMT, LYK, PSCTK2
Clonality: Polyclonal
Isotype: IgG
NCBI: 3702
UniProt: Q08881
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWYN
Target: ITK
Antibody Type: Monoclonal Antibody
HPA043670-100ul