Anti-RPL5
Catalog Number:
ATA-HPA043717
| Article Name: |
Anti-RPL5 |
| Biozol Catalog Number: |
ATA-HPA043717 |
| Supplier Catalog Number: |
HPA043717 |
| Alternative Catalog Number: |
ATA-HPA043717-100,ATA-HPA043717-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
IHC, WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
L5, PPP1R135 |
| Clonality: |
Polyclonal |
| Concentration: |
0.1 mg/ml |
| Isotype: |
IgG |
| NCBI: |
6125 |
| UniProt: |
P46777 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
RLLNRFGMDKIYEGQVEVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEV |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: |
RPL5 |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
Immunohistochemical staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells. |
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
HPA043717-100ul |
|
HPA043717-100ul |
|
HPA043717-100ul |