Anti-TMPRSS11E

Catalog Number: ATA-HPA043816
Article Name: Anti-TMPRSS11E
Biozol Catalog Number: ATA-HPA043816
Supplier Catalog Number: HPA043816
Alternative Catalog Number: ATA-HPA043816-100,ATA-HPA043816-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DESC1, TMPRSS11E2
Clonality: Polyclonal
Concentration: 0,05
NCBI: 28983
UniProt: Q9UL52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NQKKTYNYYSTLSFTTDKLYAEFGREASNNFTEMSQRLESMVKNAFYKSPLREEFVKSQVIKFSQQKHGV
Target: TMPRSS11E
HPA043816-100ul