Anti-GFRA1

Catalog Number: ATA-HPA043829
Article Name: Anti-GFRA1
Biozol Catalog Number: ATA-HPA043829
Supplier Catalog Number: HPA043829
Alternative Catalog Number: ATA-HPA043829-100,ATA-HPA043829-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GDNFR, GDNFRA, GFR-ALPHA-1, RET1L, RETL1, TRNR1
GDNF family receptor alpha 1
Anti-GFRA1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 2674
UniProt: P56159
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: IGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GFRA1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Immunohistochemical staining of human colon shows moderate cytoplasmic positivity with granular pattern in glandular cells.
HPA043829-100ul
HPA043829-100ul
HPA043829-100ul