Anti-SRSF7

Catalog Number: ATA-HPA043850
Article Name: Anti-SRSF7
Biozol Catalog Number: ATA-HPA043850
Supplier Catalog Number: HPA043850
Alternative Catalog Number: ATA-HPA043850-100,ATA-HPA043850-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: 9G8, AAG3, HSSG1, RBM37, SFRS7, ZCCHC20, ZCRB2
serine/arginine-rich splicing factor 7
Anti-SRSF7
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 6432
UniProt: Q16629
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SRSF7
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-SRSF7 antibody. Corresponding SRSF7 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Immunohistochemical staining of human testis shows high expression.
HPA043850-100ul
HPA043850-100ul
HPA043850-100ul