Anti-HORMAD2

Catalog Number: ATA-HPA043880
Article Name: Anti-HORMAD2
Biozol Catalog Number: ATA-HPA043880
Supplier Catalog Number: HPA043880
Alternative Catalog Number: ATA-HPA043880-100,ATA-HPA043880-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CT46.2, MGC26710
Clonality: Polyclonal
Isotype: IgG
NCBI: 150280
UniProt: Q8N7B1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SHFLLFDKEPINVQVGFVSTGFHSMKVKVMTEATKVIDLENNLFRENSTTEIAHQGLDCDEEEECNDHIQRMNFVCSQQSSECSRKK
Target: HORMAD2
Antibody Type: Monoclonal Antibody
HPA043880-100ul