Anti-VWCE

Catalog Number: ATA-HPA043921
Article Name: Anti-VWCE
Biozol Catalog Number: ATA-HPA043921
Supplier Catalog Number: HPA043921
Alternative Catalog Number: ATA-HPA043921-100,ATA-HPA043921-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ32009, URG11, VWC1
von Willebrand factor C and EGF domains
Anti-VWCE
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 220001
UniProt: Q96DN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GGDECTTCVCQNGEVECSFMPCPELACPREEWRLGPGQCCFTCQEPTPSTGCSLDDNGVEFPIGQIWSPGDPCELCICQADGSVSCKRTDCVDSCP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: VWCE
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Immunohistochemical staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
Lane 4: Human plasma
Lane 5: Human Liver tissue
Lane 6: Human Tonsil tissue
HPA043921-100ul
HPA043921-100ul
HPA043921-100ul