Anti-SLC36A2
Catalog Number:
ATA-HPA044002
- Images (6)
| Article Name: | Anti-SLC36A2 |
| Biozol Catalog Number: | ATA-HPA044002 |
| Supplier Catalog Number: | HPA044002 |
| Alternative Catalog Number: | ATA-HPA044002-100,ATA-HPA044002-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PAT2, TRAMD1, tramdorin |
| solute carrier family 36 (proton/amino acid symporter), member 2 |
| Anti-SLC36A2 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 153201 |
| UniProt: | Q495M3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QGAVAIKLDLMSPPESAKKLENKDSTFLDESPSESAGLKKTKGITVF |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC36A2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-SLC36A2 antibody. Corresponding SLC36A2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows high expression. |
|
|
Immunohistochemical staining of human lymph node shows low expression as expected. |
|
|
HPA044002-100ul |
|
|
HPA044002-100ul |
|
|
HPA044002-100ul |
Product Guarantee and Expert Support
