Anti-WDR35
Catalog Number:
ATA-HPA044147
- Images (6)
| Article Name: | Anti-WDR35 |
| Biozol Catalog Number: | ATA-HPA044147 |
| Supplier Catalog Number: | HPA044147 |
| Alternative Catalog Number: | ATA-HPA044147-100,ATA-HPA044147-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | IFT121, IFTA1, KIAA1336, MGC33196 |
| WD repeat domain 35 |
| Anti-WDR35 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 57539 |
| UniProt: | Q9P2L0 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SLPNVGLIQKYSLNCRAYQLSLNCNSSRLAIIDISGVLTFFDLDARVTDSTGQQVVGELLKLERRDVWDMKWAKDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGY |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | WDR35 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in neurons. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA044147-100ul |
|
|
HPA044147-100ul |
|
|
HPA044147-100ul |
Product Guarantee and Expert Support
