Anti-ADAM32
Catalog Number:
ATA-HPA044156
- Images (8)
| Article Name: | Anti-ADAM32 |
| Biozol Catalog Number: | ATA-HPA044156 |
| Supplier Catalog Number: | HPA044156 |
| Alternative Catalog Number: | ATA-HPA044156-100,ATA-HPA044156-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ADAM32 |
| ADAM metallopeptidase domain 32 |
| Anti-ADAM32 |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 203102 |
| UniProt: | Q8TC27 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DYKLPRTVPDPLAVKNGSQCDIGRVCVNRECVESRIIKASAHVCSQQCSGHGVCDSRNKCHCSPGYKPPNCQIRSKGFSIFPEEDMGSIME |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ADAM32 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human testis and prostate tissues using Anti-ADAM32 antibody. Corresponding ADAM32 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human prostate shows low expression as expected. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and ADAM32 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408141). |
|
|
HPA044156-100ul |
|
|
|
|
|
HPA044156-100ul |
|
|
HPA044156-100ul |
Product Guarantee and Expert Support
