Anti-SLC22A8
Catalog Number:
ATA-HPA044174
- Images (6)
| Article Name: | Anti-SLC22A8 |
| Biozol Catalog Number: | ATA-HPA044174 |
| Supplier Catalog Number: | HPA044174 |
| Alternative Catalog Number: | ATA-HPA044174-100,ATA-HPA044174-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | OAT3 |
| solute carrier family 22 (organic anion transporter), member 8 |
| Anti-SLC22A8 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 9376 |
| UniProt: | Q8TCC7 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KKEEGERLSLEELKLNLQKEISLAKAKYTASDLFRIPMLR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC22A8 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:2500 - 1:5000 |
|
|
Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-SLC22A8 antibody. Corresponding SLC22A8 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows high expression. |
|
|
Immunohistochemical staining of human lymph node shows low expression as expected. |
|
|
HPA044174-100ul |
|
|
HPA044174-100ul |
|
|
HPA044174-100ul |
Product Guarantee and Expert Support
