Anti-COMMD2

Catalog Number: ATA-HPA044190
Article Name: Anti-COMMD2
Biozol Catalog Number: ATA-HPA044190
Supplier Catalog Number: HPA044190
Alternative Catalog Number: ATA-HPA044190-100,ATA-HPA044190-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HSPC042
COMM domain containing 2
Anti-COMMD2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 51122
UniProt: Q86X83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FVLGFSEELNKLLLQLYLDNRKEIRTLLSELAPSLPSYHNLEWRLDVQLASRSLRQQIKPAVTIKLHLNQNGDHNTKVLQTDPATLLHLVQQLEQALE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: COMMD2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA044190-100ul
HPA044190-100ul
HPA044190-100ul