Anti-LHX1

Catalog Number: ATA-HPA044307
Article Name: Anti-LHX1
Biozol Catalog Number: ATA-HPA044307
Supplier Catalog Number: HPA044307
Alternative Catalog Number: ATA-HPA044307-100,ATA-HPA044307-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: LIM-1, LIM1
Clonality: Polyclonal
Isotype: IgG
NCBI: 3975
UniProt: P48742
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NGPFSFYGDYQSEYYGPGGNYDFFPQGPPSSQAQTPVDLPFVPSSGPSGTPLGGLEHPLPGHHPSSEAQRFTDILAHPPGDSPSPEPSLPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHL
Target: LHX1
Antibody Type: Monoclonal Antibody
HPA044307-100ul