Anti-DHX40
Catalog Number:
ATA-HPA044350
- Images (9)
| Article Name: | Anti-DHX40 |
| Biozol Catalog Number: | ATA-HPA044350 |
| Supplier Catalog Number: | HPA044350 |
| Alternative Catalog Number: | ATA-HPA044350-100,ATA-HPA044350-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ARG147, DDX40, FLJ22060, PAD |
| DEAH (Asp-Glu-Ala-His) box polypeptide 40 |
| Anti-DHX40 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 79665 |
| UniProt: | Q8IX18 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SVGRTFCTMDGRGSPVHIHPSSALHEQETKLEWIIFHEVLVTTKVYARIVCPIRYEWVRDLLPKLHEFNAHDLSSVARREVREDARRRWTNKENVKQLKDGISKDVLKKMQRRNDDKSISDARARF |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DHX40 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human testis shows strong nuclear and cytoplasmic positivity in Leydig cells and moderate nuclear staining in subsets of cells in seminiferus ducts. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA044350-100ul |
|
|
|
|
|
|
|
|
HPA044350-100ul |
|
|
HPA044350-100ul |
Product Guarantee and Expert Support
