Anti-GABRD

Catalog Number: ATA-HPA044371
Article Name: Anti-GABRD
Biozol Catalog Number: ATA-HPA044371
Supplier Catalog Number: HPA044371
Alternative Catalog Number: ATA-HPA044371-100,ATA-HPA044371-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GABRD
gamma-aminobutyric acid (GABA) A receptor, delta
Anti-GABRD
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 2563
UniProt: O14764
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KVKVSRPRAEMDVRNAIVLFSLSAAGVTQELAISRRQRRVPGNLMGSYRSVGVETGETKKEGAARSGGQGGIRARL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GABRD
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:1000 - 1:2500
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-GABRD antibody. Corresponding GABRD RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA044371-100ul
HPA044371-100ul
HPA044371-100ul