Anti-KIAA1324L
Catalog Number:
ATA-HPA044527
- Images (6)
| Article Name: | Anti-KIAA1324L |
| Biozol Catalog Number: | ATA-HPA044527 |
| Supplier Catalog Number: | HPA044527 |
| Alternative Catalog Number: | ATA-HPA044527-100,ATA-HPA044527-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | EIG121L, FLJ31340 |
| KIAA1324-like |
| Anti-KIAA1324L |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 222223 |
| UniProt: | A8MWY0 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TLCSADCVLYFMVDINRKSTNVVESWGGTKEKQAYTHIIFKNATFTFTWAFQRTNQGQDNRRFINDMVKIYSITATNAVDGVASSCRACALGSEQSGSSCVPCPPGHYIEKETNQCKECPPD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | KIAA1324L |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human caudate shows strong cytoplasmic positivity in neurons. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: RT-4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA044527-100ul |
|
|
HPA044527-100ul |
|
|
HPA044527-100ul |
Product Guarantee and Expert Support
