Anti-SMR3A
Catalog Number:
ATA-HPA044567
- Images (6)
| Article Name: | Anti-SMR3A |
| Biozol Catalog Number: | ATA-HPA044567 |
| Supplier Catalog Number: | HPA044567 |
| Alternative Catalog Number: | ATA-HPA044567-100,ATA-HPA044567-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PBI, PRL5, PROL5 |
| submaxillary gland androgen regulated protein 3A |
| Anti-SMR3A |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 26952 |
| UniProt: | Q99954 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GPGRIQSHSLPPPYGPGYPQPPSQPRPYPPGPPFFPVNSPTDPALPTPAP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SMR3A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human salivary gland and colon tissues using Anti-SMR3A antibody. Corresponding SMR3A RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human salivary gland shows high expression. |
|
|
Immunohistochemical staining of human colon shows low expression as expected. |
|
|
HPA044567-100ul |
|
|
HPA044567-100ul |
|
|
HPA044567-100ul |
Product Guarantee and Expert Support
