Anti-BHMT2

Catalog Number: ATA-HPA044573
Article Name: Anti-BHMT2
Biozol Catalog Number: ATA-HPA044573
Supplier Catalog Number: HPA044573
Alternative Catalog Number: ATA-HPA044573-100,ATA-HPA044573-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BHMT2
betaine--homocysteine S-methyltransferase 2
Anti-BHMT2
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 23743
UniProt: Q9H2M3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FTFSASEDNMESKWEDVNAAACDLAREVAGKGDALVAGGICQTSIYKYQKDEA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: BHMT2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-BHMT2 antibody. Corresponding BHMT2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney shows high expression.
Immunohistochemical staining of human lymph node shows low expression as expected.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
Lane 1: Mouse liver tissue lysate
Lane 2: Rat liver tissue lysate
HPA044573-100ul
HPA044573-100ul
HPA044573-100ul