Anti-C6orf132

Catalog Number: ATA-HPA044588
Article Name: Anti-C6orf132
Biozol Catalog Number: ATA-HPA044588
Supplier Catalog Number: HPA044588
Alternative Catalog Number: ATA-HPA044588-100,ATA-HPA044588-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: bA7K24.2
chromosome 6 open reading frame 132
Anti-C6orf132
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 647024
UniProt: Q5T0Z8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QGTFSKLFGKKHTTTPSTSLYATNPPWIFTQEAPEEGTGGFDGIYYGDNRFNTVSESGTATLKARPRVRPLLTFLPLNAQEN
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: C6orf132
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus.
Immunohistochemistry analysis in human esophagus and colon tissues using Anti-C6orf132 antibody. Corresponding C6orf132 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human esophagus shows high expression.
Immunohistochemical staining of human colon shows low expression as expected.
HPA044588-100ul
HPA044588-100ul
HPA044588-100ul