Anti-SPOCK2

Catalog Number: ATA-HPA044605
Article Name: Anti-SPOCK2
Biozol Catalog Number: ATA-HPA044605
Supplier Catalog Number: HPA044605
Alternative Catalog Number: ATA-HPA044605-100,ATA-HPA044605-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0275, testican-2
sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 2
Anti-SPOCK2
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 9806
UniProt: Q92563
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EQQACLSSKQLAVRCEGPCPCPTEQAATSTADGKPETCTGQDLADLGDRLRDWFQLLHENSKQNGSASSVAGPASGLDKSLGASCKDS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SPOCK2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and SPOCK2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY414995).
HPA044605-100ul
HPA044605-100ul
HPA044605-100ul