Anti-ATP5L

Catalog Number: ATA-HPA044629
Article Name: Anti-ATP5L
Biozol Catalog Number: ATA-HPA044629
Supplier Catalog Number: HPA044629
Alternative Catalog Number: ATA-HPA044629-100,ATA-HPA044629-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ATP5JG
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit G
Anti-ATP5L
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 10632
UniProt: O75964
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: AQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ATP5L
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA044629-100ul
HPA044629-100ul
HPA044629-100ul