Anti-CLCN3
Catalog Number:
ATA-HPA044723
- Images (6)
| Article Name: | Anti-CLCN3 |
| Biozol Catalog Number: | ATA-HPA044723 |
| Supplier Catalog Number: | HPA044723 |
| Alternative Catalog Number: | ATA-HPA044723-100,ATA-HPA044723-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ClC-3, CLC3 |
| chloride channel, voltage-sensitive 3 |
| Anti-CLCN3 |
| Clonality: | Polyclonal |
| Concentration: | 0.6 mg/ml |
| Isotype: | IgG |
| NCBI: | 1182 |
| UniProt: | P51790 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NSITSASSDEELLDGAGVIMDFQTSEDDNLLDGDTAVGTHYTMTNGGSINSSTHLLDLLDEP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CLCN3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue |
|
|
Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate |
|
|
HPA044723-100ul |
|
|
HPA044723-100ul |
|
|
HPA044723-100ul |
Product Guarantee and Expert Support
