Anti-CT45A1
Catalog Number:
ATA-HPA044735
- Images (9)
| Article Name: | Anti-CT45A1 |
| Biozol Catalog Number: | ATA-HPA044735 |
| Supplier Catalog Number: | HPA044735 |
| Alternative Catalog Number: | ATA-HPA044735-100,ATA-HPA044735-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CT45-1, CT45.1 |
| cancer/testis antigen family 45, member A1 |
| Anti-CT45A1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 541466 |
| UniProt: | Q5HYN5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CT45A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli. |
|
|
Immunohistochemistry analysis in human testis and liver tissues using HPA044735 antibody. Corresponding CT45A1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
HPA044735-100ul |
|
|
|
|
|
|
|
|
HPA044735-100ul |
|
|
HPA044735-100ul |
Product Guarantee and Expert Support
