Anti-SHPRH

Catalog Number: ATA-HPA044852
Article Name: Anti-SHPRH
Biozol Catalog Number: ATA-HPA044852
Supplier Catalog Number: HPA044852
Alternative Catalog Number: ATA-HPA044852-100,ATA-HPA044852-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: bA545I5.2, FLJ90837, KIAA2023
Clonality: Polyclonal
Isotype: IgG
NCBI: 257218
UniProt: Q149N8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RHPGIPPTLRDGRLEEEAKQLREHYMSKCNTEVAEAQQALYPVQQTIHELQRKIHSNSPWWLNVIHRAIEFTIDEELVQRVRNEITSNYKQQTGKLSMSEKFRDCR
Target: SHPRH
Antibody Type: Monoclonal Antibody
HPA044852-100ul