Anti-ZNF766

Catalog Number: ATA-HPA044882
Article Name: Anti-ZNF766
Biozol Catalog Number: ATA-HPA044882
Supplier Catalog Number: HPA044882
Alternative Catalog Number: ATA-HPA044882-100,ATA-HPA044882-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ZNF766
zinc finger protein 766
Anti-ZNF766
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 90321
UniProt: Q5HY98
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ISMMKQRTEPWTVENEMKVAKNPDRWEGIKDINTGRSCAVRSKAGNKPITNQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ZNF766
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome.
Immunohistochemical staining of human testis shows strong cytoplasmic and nuclear positivity in cells of seminiferus ducts.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
HPA044882-100ul
HPA044882-100ul
HPA044882-100ul