Anti-MIIP
Catalog Number:
ATA-HPA044948
- Images (9)
| Article Name: | Anti-MIIP |
| Biozol Catalog Number: | ATA-HPA044948 |
| Supplier Catalog Number: | HPA044948 |
| Alternative Catalog Number: | ATA-HPA044948-100,ATA-HPA044948-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ12438, IIp45 |
| migration and invasion inhibitory protein |
| Anti-MIIP |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 60672 |
| UniProt: | Q5JXC2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SDTLALPRHCLLGWDIFPPKSEKSSAPRNLDLWSSVSAEAQHQKLSGTSSPFHPASPMQMLPPTPTWSVPQVPRPHVPRQKP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MIIP |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human lung shows moderate cytoplasmic positivity in macrophages. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
Immunohistochemical staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neuronal cells. |
|
|
Immunohistochemical staining of human testis shows weak cytoplasmic positivity in spermatogonia. |
|
|
HPA044948-100ul |
|
|
|
|
|
HPA044948-100ul |
|
|
HPA044948-100ul |
Product Guarantee and Expert Support
