Anti-CST6
Catalog Number:
ATA-HPA044963
- Images (6)
| Article Name: | Anti-CST6 |
| Biozol Catalog Number: | ATA-HPA044963 |
| Supplier Catalog Number: | HPA044963 |
| Alternative Catalog Number: | ATA-HPA044963-100,ATA-HPA044963-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CST6 |
| cystatin E/M |
| Anti-CST6 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 1474 |
| UniProt: | Q15828 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CST6 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human skin and skeletal muscle tissues using Anti-CST6 antibody. Corresponding CST6 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skin shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
HPA044963-100ul |
|
|
HPA044963-100ul |
|
|
HPA044963-100ul |
Product Guarantee and Expert Support
