Anti-TRPV2
Catalog Number:
ATA-HPA044993
- Images (9)
| Article Name: | Anti-TRPV2 |
| Biozol Catalog Number: | ATA-HPA044993 |
| Supplier Catalog Number: | HPA044993 |
| Alternative Catalog Number: | ATA-HPA044993-100,ATA-HPA044993-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | VRL, VRL-1, VRL1 |
| transient receptor potential cation channel, subfamily V, member 2 |
| Anti-TRPV2 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 51393 |
| UniProt: | Q9Y5S1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNYRKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TRPV2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line SK-MEL-30 shows localization to plasma membrane. |
|
|
Immunohistochemical staining of human gastrointestinal shows strong cytoplasmic positivity in peripheral ganglion. |
|
|
Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells. |
|
|
Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in endothelial cells. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
HPA044993-100ul |
|
|
|
|
|
HPA044993-100ul |
|
|
HPA044993-100ul |
Product Guarantee and Expert Support
