Anti-JPH4

Catalog Number: ATA-HPA045022
Article Name: Anti-JPH4
Biozol Catalog Number: ATA-HPA045022
Supplier Catalog Number: HPA045022
Alternative Catalog Number: ATA-HPA045022-100,ATA-HPA045022-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: JPHL1, KIAA1831
Clonality: Polyclonal
Concentration: 0,3
NCBI: 84502
UniProt: Q96JJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PSSPASSRQPWRPPACRSPLPPGGDQGPFSSPKAWPEEWGGAGAQAEELAGYEAEDEAGMQGPGPRDGSPLLGGCSDSSGSLREEE
Target: JPH4
HPA045022-100ul