Anti-OSER1

Catalog Number: ATA-HPA045125
Article Name: Anti-OSER1
Biozol Catalog Number: ATA-HPA045125
Supplier Catalog Number: HPA045125
Alternative Catalog Number: ATA-HPA045125-100,ATA-HPA045125-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C20orf111, dJ1183I21.1, HSPC207, Osr1, Perit1
oxidative stress responsive serine-rich 1
Anti-OSER1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 51526
UniProt: Q9NX31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GKPCTCIGKECQCKRWHDMEVYSFSGLQSVPPLAPERRSTLEDYSQSLHARTLSGSPRSCSEQARVFVDDVTIEDLSGYMEYYLYIPKKMS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: OSER1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoli & nuclear speckles.
Immunohistochemical staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules.
Western blot analysis in control (vector only transfected HEK293T lysate) and OSER1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413969).
HPA045125-100ul
HPA045125-100ul
HPA045125-100ul