Anti-RPP38
Catalog Number:
ATA-HPA045128
- Images (6)
| Article Name: | Anti-RPP38 |
| Biozol Catalog Number: | ATA-HPA045128 |
| Supplier Catalog Number: | HPA045128 |
| Alternative Catalog Number: | ATA-HPA045128-100,ATA-HPA045128-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | RPP38 |
| ribonuclease P/MRP 38kDa subunit |
| Anti-RPP38 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 10557 |
| UniProt: | P78345 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FVDEVRAIIPRVPSLSVPWLQDRIEDSGENLETEPLESQDRELLDTSFEDLSKPKRKLADGRQASVTLQPLKIKKLIPNPNKIRKPPKS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RPP38 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center. |
|
|
Western blot analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RPP38 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RPP38 antibody. Remaining relative intensity is presented |
|
|
HPA045128-100ul |
|
|
HPA045128-100ul |
|
|
HPA045128-100ul |
Product Guarantee and Expert Support
