Anti-ZMIZ1
Catalog Number:
ATA-HPA045144
| Article Name: |
Anti-ZMIZ1 |
| Biozol Catalog Number: |
ATA-HPA045144 |
| Supplier Catalog Number: |
HPA045144 |
| Alternative Catalog Number: |
ATA-HPA045144-100,ATA-HPA045144-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
ICC, IHC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
FLJ13541, hZIMP10, KIAA1224, MIZ, RAI17, RP11-519K18.1, Zimp10 |
| zinc finger, MIZ-type containing 1 |
| Clonality: |
Polyclonal |
| Concentration: |
0.1 mg/ml |
| Isotype: |
IgG |
| NCBI: |
57178 |
| UniProt: |
Q9ULJ6 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
MNSMDRHIQQTNDRLQCIKQHLQNPANFHNAATELLDWCGDPRAFQRPFEQSLMGCLTVVSRVAAQQGFDLDLGYRLLAVCAANRDKFT |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: |
ZMIZ1 |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & vesicles. |
|
Immunohistochemical staining of human gallbladder shows cytoplasmic positivity in glandular cells. |
|
HPA045144-100ul |
|
|
|
HPA045144-100ul |
|
HPA045144-100ul |