Anti-C2orf69

Catalog Number: ATA-HPA045225
Article Name: Anti-C2orf69
Biozol Catalog Number: ATA-HPA045225
Supplier Catalog Number: HPA045225
Alternative Catalog Number: ATA-HPA045225-100,ATA-HPA045225-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ38973
chromosome 2 open reading frame 69
Anti-C2orf69
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 205327
UniProt: Q8N8R5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QHHVLYFPGDVQNYHEIMTRHPENYQWENWSLENVATILAHRFPNSYIWVIKCSRMHLHKFSCYDNFVKSNMFGAPEH
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: C2orf69
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human kidney shows strong cytoplasmic and extracellular positivity in cells in tubules.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA045225-100ul
HPA045225-100ul
HPA045225-100ul