Anti-EEF1AKMT3

Catalog Number: ATA-HPA045492
Article Name: Anti-EEF1AKMT3
Biozol Catalog Number: ATA-HPA045492
Supplier Catalog Number: HPA045492
Alternative Catalog Number: ATA-HPA045492-100,ATA-HPA045492-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZP586D0919, FAM119B, METTL21B
Clonality: Polyclonal
Isotype: IgG
NCBI: 25895
UniProt: Q96AZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GILAALQGGDVTITDLPLALEQIQGNVQANVPAGGQAQVRALSWGIDHHVFPANYDLVLGADIVYLEPT
Target: EEF1AKMT3
Antibody Type: Monoclonal Antibody
HPA045492-100ul