Anti-SKA1 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA045495
Article Name: Anti-SKA1 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA045495
Supplier Catalog Number: HPA045495
Alternative Catalog Number: ATA-HPA045495-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C18orf24, MGC10200
Clonality: Polyclonal
NCBI: 220134
UniProt: Q96BD8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ELLNKLELEIQYQEQTNNSLKELCESLEEDYKDIEHLKENIPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEM
Target: SKA1