Anti-MICU2
Catalog Number:
ATA-HPA045511
- Images (7)
| Article Name: | Anti-MICU2 |
| Biozol Catalog Number: | ATA-HPA045511 |
| Supplier Catalog Number: | HPA045511 |
| Alternative Catalog Number: | ATA-HPA045511-100,ATA-HPA045511-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | EFHA1 |
| mitochondrial calcium uptake 2 |
| Anti-MICU2 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 221154 |
| UniProt: | Q8IYU8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LAAAVAGAALAGAGAAWHHSRVSVAARDGSFTVSAQKNVEHGIIYIGKPSLRKQRFMQFSSLEHEGEYYMTPRDFLFSVMFEQMERKTSVKKLTKKDIEDTLSGIQT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MICU2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human fallopian tube shows strong cytoplasmic granular positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic granular positivity in neurons. |
|
|
Immunohistochemical staining of human small intestine shows strong cytoplasmic granular positivity in glandular cells. |
|
|
HPA045511-100ul |
|
|
HPA045511-100ul |
|
|
HPA045511-100ul |
Product Guarantee and Expert Support
