Anti-NPEPPS
Catalog Number:
ATA-HPA045649
- Images (6)
| Article Name: | Anti-NPEPPS |
| Biozol Catalog Number: | ATA-HPA045649 |
| Supplier Catalog Number: | HPA045649 |
| Alternative Catalog Number: | ATA-HPA045649-100,ATA-HPA045649-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MP100, PSA |
| aminopeptidase puromycin sensitive |
| Anti-NPEPPS |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 9520 |
| UniProt: | P55786 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VMNCADIDIITASYAPEGDEEIHATGFNYQNEDEKVTLSFPSTLQTGTGTLKIDFVGELNDKMKGFYRSKYTTPSGEVRYAAVTQFEA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NPEPPS |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human pancreas shows moderate cytoplasmic and nuclear positivity in exocrine glandular cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
HPA045649-100ul |
|
|
|
|
|
HPA045649-100ul |
|
|
HPA045649-100ul |
Product Guarantee and Expert Support
