Anti-RIIAD1

Catalog Number: ATA-HPA045703
Article Name: Anti-RIIAD1
Biozol Catalog Number: ATA-HPA045703
Supplier Catalog Number: HPA045703
Alternative Catalog Number: ATA-HPA045703-100,ATA-HPA045703-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C1orf230, FLJ36032, NCRNA00166
regulatory subunit of type II PKA R-subunit (RIIa) domain containing 1
Anti-RIIAD1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Isotype: IgG
NCBI: 284485
UniProt: A6NNX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: METLPGLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKRPDNILEFAADYFTDPRLPNKIH
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RIIAD1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:1000 - 1:2500
Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-RIIAD1 antibody. Corresponding RIIAD1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
HPA045703-100ul
HPA045703-100ul
HPA045703-100ul