Anti-NSL1
Catalog Number:
ATA-HPA045761
- Images (6)
| Article Name: | Anti-NSL1 |
| Biozol Catalog Number: | ATA-HPA045761 |
| Supplier Catalog Number: | HPA045761 |
| Alternative Catalog Number: | ATA-HPA045761-100,ATA-HPA045761-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C1orf48, DC8, DKFZP566O1646, MIS14 |
| NSL1, MIS12 kinetochore complex component |
| Anti-NSL1 |
| Clonality: | Polyclonal |
| Concentration: | 0.9 mg/ml |
| Isotype: | IgG |
| NCBI: | 25936 |
| UniProt: | Q96IY1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FVQKLGDALPEEIREPALRDAQWTFESAVQENISINGQAWQEASDNCFMDSDIKVLEDQFDEIIVDIATKRKQYP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NSL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human lymph node and pancreas tissues using Anti-NSL1 antibody. Corresponding NSL1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lymph node shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
HPA045761-100ul |
|
|
HPA045761-100ul |
|
|
HPA045761-100ul |
Product Guarantee and Expert Support
