Anti-UTP11

Catalog Number: ATA-HPA045830
Article Name: Anti-UTP11
Biozol Catalog Number: ATA-HPA045830
Supplier Catalog Number: HPA045830
Alternative Catalog Number: ATA-HPA045830-100,ATA-HPA045830-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CGI-94, UTP11L
UTP11, small subunit processome component homolog (S. cerevisiae)
Anti-UTP11
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 51118
UniProt: Q9Y3A2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: HIIKETKEEVTPEQLKLMRTQDVKYIEMKRVAEAKKIERLKSELHLLDFQGKQQNKHVFFFDTKKEVEQFDVATHLQTAPEL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: UTP11
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Immunohistochemical staining of human cerebellum shows strong nucleolar positivity in Purkinje cells.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
HPA045830-100ul
HPA045830-100ul
HPA045830-100ul